PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.252700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 292aa    MW: 33302.9 Da    PI: 5.1628
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.252700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l ++++  G g+W++ ++  g+ R++k+c++rw +yl
   Cucsa.252700.1 14 RGRWTAEEDEILTNYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding54.72.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ TteE++ +v++++ +G++ W++Ia +++ gRt++++k++w+++l
   Cucsa.252700.1  67 RGNITTEEEQMIVKLHNVFGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.496961IPR017930Myb domain
SuperFamilySSF466894.49E-2911108IPR009057Homeodomain-like
SMARTSM007174.7E-121363IPR001005SANT/Myb domain
PfamPF002493.5E-141461IPR001005SANT/Myb domain
CDDcd001675.61E-81661No hitNo description
PROSITE profilePS5129424.21362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-2565116IPR009057Homeodomain-like
SMARTSM007173.2E-1666114IPR001005SANT/Myb domain
PfamPF002497.9E-1567112IPR001005SANT/Myb domain
CDDcd001671.93E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MVRAPCCEKV GLKRGRWTAE EDEILTNYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRTDLKRGNI TTEEEQMIVK LHNVFGNRWS LIAGHLPGRT DNEIKNYWNS HLSRRIYTMT  120
RLSAKSSSPI TGILDITPAS KRKRNISKSA QQQAATVKMK TTEKEKVEKG LSSEEDDKED  180
EDGLGNSRVV LNDGGEEDLG PYDWLDGEIM RLNNEIIEWG MGESRGNNNN GCNEKVRCTE  240
DHNHNYGSNC SSSVNSALEM DQWLNWDWDH QDNGSMEGCS LDQWELEEIS SW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23121185110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBMTransfer from AT5G49330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004134499.10.0PREDICTED: myb-related protein 308
SwissprotO222642e-73MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A0A0LAP11e-122A0A0A0LAP1_CUCSA; Uncharacterized protein
STRINGGLYMA17G03480.26e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.11e-76myb domain protein 111